SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A170W608 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A170W608
Domain Number 1 Region: 30-71
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.000000000392
Family a tRNA synthase domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A170W608
Sequence length 74
Comment (tr|A0A170W608|A0A170W608_TRIIF) Methionine--trna ligase, cytoplasmic {ECO:0000313|EMBL:JAR97230.1} OX=30076 OS=Triatoma infestans (Assassin bug). GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Triatoma.
Sequence
QKSQSPDPVTVNNTKPVSNPSIGDAALAITTLEEAVTKQGDLVRSMKAAGKSKDELKPMI
ATLLDLKKQLSVLK
Download sequence
Identical sequences A0A170W608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]