SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A173TTA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A173TTA3
Domain Number 1 Region: 42-114
Classification Level Classification E-value
Superfamily CPE0013-like 5.89e-22
Family CPE0013-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A173TTA3
Sequence length 120
Comment (tr|A0A173TTA3|A0A173TTA3_9FIRM) Uncharacterized protein with conserved CXXC pairs {ECO:0000313|EMBL:CUN05095.1} KW=Complete proteome OX=154288 OS=Turicibacter sanguinis. GN=ERS852379_02304 OC=Erysipelotrichaceae; Turicibacter.
Sequence
MSQALTCIVCPVGCSLNIDEEGHVSGNHCKRGLAFAKSETTNPTRVVTTTIAIEGAIYRR
LPVVSSQPVPKSKMMEFVKAVQLIKVEAPVSCGDVILSDVLGLGIDVIASRTLKRCQDVK
Download sequence
Identical sequences A0A173TTA3 D4W4P9
WP_006784349.1.38559 WP_006784349.1.61036 WP_006784349.1.81979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]