SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A173U341 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A173U341
Domain Number 1 Region: 6-241
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.83e-73
Family LplA-like 0.00000445
Further Details:      
 
Domain Number 2 Region: 243-329
Classification Level Classification E-value
Superfamily SufE/NifU 3.92e-16
Family SP1160 C-terminal domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A173U341
Sequence length 331
Comment (tr|A0A173U341|A0A173U341_9FIRM) Lipoate--protein ligase {ECO:0000256|SAAS:SAAS00603724} KW=Complete proteome OX=53443 OS=Blautia hydrogenotrophica. GN=ERS852414_02614 OC=Blautia.
Sequence
MTERIVYLETDSTDPYDNLALEEALLEEAAPGKCILYLWQNQNTVVIGRNQNCWKECAVE
ELEQSGGHLARRLSGGGAVYHDLGNLNFTFLASKEDYHLGKQMEVIQRAVRAFGLNAQKN
GRNDLTLDGKKFSGNAFYEAKGKCYHHGTILISADKEKAARFLNVDMQKLKSKGVESVRS
RIENLQTYCRDVTVENMKQSLIYAFSLIYGCCPQRMTQEELPRRRIEELERKYRSWEWTY
GRKIPFTHTFSRRFSWGDFELQLQVEAGRIENVNVFSDSLDSHIYRLGENLRGIKYGKAE
ILQALEAGMEKAGVFQECRRDIIGLLEAQMW
Download sequence
Identical sequences A0A173U341 A0A1C5V8Q1 C0CMQ1 R5BVK1
WP_005949234.1.16231 WP_005949234.1.89365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]