SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A173VHU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A173VHU0
Domain Number - Region: 70-98
Classification Level Classification E-value
Superfamily Viral glycoprotein ectodomain-like 0.0471
Family Spike glycoprotein-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A173VHU0
Sequence length 151
Comment (tr|A0A173VHU0|A0A173VHU0_9FIRM) Uncharacterized conserved protein {ECO:0000313|EMBL:CUN26932.1} KW=Complete proteome OX=166486 OS=Roseburia intestinalis. GN=ERS852572_03038 OC=Roseburia.
Sequence
MFIQFIVSMIATLSFAVLFCAPKSELLFCGLTGAIGWIVYLICLQFDTGTVIANMIATLA
LTVFSRMVAALRKNPVTVYLIAGIFPLVPGAGIYYTSYYFIMNNMSEFSRYGMETIKVAG
AIVLGIIFGFSLPQAWFNALQHRTKRQSSHA
Download sequence
Identical sequences A0A173VHU0 R6BRZ3
WP_022113152.1.14300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]