SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A174T245 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A174T245
Domain Number 1 Region: 794-976,1012-1077
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.51e-30
Family Tandem AAA-ATPase domain 0.0086
Further Details:      
 
Domain Number 2 Region: 686-831
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000112
Family Tandem AAA-ATPase domain 0.048
Further Details:      
 
Weak hits

Sequence:  A0A174T245
Domain Number - Region: 444-519
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0034
Family Capz alpha-1 subunit 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A174T245
Sequence length 1100
Comment (tr|A0A174T245|A0A174T245_9FIRM) Exodeoxyribonuclease V subunit alpha {ECO:0000313|EMBL:CUQ02621.1} KW=Complete proteome OX=1531 OS=[Clostridium] clostridioforme. GN=ERS852480_04673 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MHLNNSDLIRRHISTHSERSAEDRAAVSALETFLASDGKINTNFSCDDKWPNHDGTFEFV
SNPEISRCPEQNFIVQIKGTHNYTETNGIISYSLKSLAFPAFIAKEVTADPGILFIVLNP
DVRGEKRVFWKYVSPGFIKSIDFEKNSTTIKLNAEDEIKDTDESVNIFCNKLKRIIDFHL
FLNKLNKNNLKKEDAIKIIETRCEDISLEIDRINNENKSRDNISRRIVNGLYDLCYATLI
LNAINLGYTDVNERLAWELSQFNIETQYLSKFLKGLKYIGSRIPDEGQSERLMLKYYSYL
WEIRKFLKNNFSILVLENLESFPLHTDTLDTEYYEMVVSSIAAIDLSPKNVRTSRYYIQK
KTPFFVNGERYFEITLQLAGLYATKFNRITVYTKQNISTNYSIQIAYADAEINLWGANSK
IKVVTNWKVSINPSCLNKLGKVLHISTNLNKNYGEYTSLMDFLTKTGINLLDLINLHENR
YQNALHQIYGGTKTNTFEEVFFKLRRDYALSSNKMGKHTVRYILLNLREEILESVLPNTF
DKKCLTEELYITSRCYPFEKKPFISNLAGRKTSKGNINDILEITNGSEQYNTVYPYLTIE
SLIYKTGELYFDVDSVASMEKIKKYNDSLDAWECSNGFRINEENGYLSIDSYEANTLFIL
EKLLKLSKVSNRGQQESNSRYLRESNLKFEDPLKKVALQKVFVKSQVMLIYGAAGTGKTT
LINYVSNMMMQSKKLFLTKTHTALQNLKRRIENPGSESDFVSIDSFTKMVTLTDYDVIFI
DECSTIDNRTMGKMLEKIDDDTLLVLAGDIYQIESIDFGNWFYYAKDIIKTDGANVELLN
TWRTEKEELKSLWDGVRKIEPIITEKLAIDGPFSSDIGEEIFVSKDEDEIVLCLNYDGKF
GLNNMNLYFQNANTKSEVYSWAEWTFKVGDPIIFLDTKRSSLLYNNLKGRIVDISKSDSA
ILFTLDIDTILTERQCRNESFEFVDVTDFGTRICLEVIASIEELEDDEERVKTIIPFQIA
YAVSIHKAQGLEYKSVKIIIPSYNAEKISHSIFYTAITRAKEKLKIYWSAETMQDIIESF
TKEKDESWTHSMIKKKLDLE
Download sequence
Identical sequences A0A0U5PK15 A0A174T245 R6K2Z1
WP_022200838.1.80145 WP_022200838.1.89345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]