SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A175CJ41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A175CJ41
Domain Number 1 Region: 7-238
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.76e-72
Family Pseudouridine synthase II TruB 0.000013
Further Details:      
 
Weak hits

Sequence:  A0A175CJ41
Domain Number - Region: 261-300
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0262
Family Capz beta-1 subunit 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A175CJ41
Sequence length 302
Comment (tr|A0A175CJ41|A0A175CJ41_LEUGE) tRNA-uridine isomerase {ECO:0000256|HAMAP-Rule:MF_01080} KW=Complete proteome OX=115778 OS=Leuconostoc gelidum subsp. gasicomitatum. GN=PL111_1509 OC=Leuconostoc.
Sequence
MQHNNNVDGLIVVNKPRGVTSFDVVAKVRRAIGQKKVGHAGTLDPNVDGVLVVALGKATK
LIDELQTRPKQYVGSITLGFATETEDLDGEVISKVDIDVPFTDAAIDTAIANLNGAIKQV
PPMFSAVKVGGKRLYEYARAGEDVTRPIREALIYDYKRIGATIYENKQQHFDFEATVSKG
TYIRTLAVDTGLQLGVPATMSSLTRTMGSGITIAHAANLDDIATIAQSELLKLIIPIKDV
LTWPTKALSDDEWFAVKNGQKIATWPASDTYLQLTYHDDVKAVYAYNKEDNVWQSRYVFT
NE
Download sequence
Identical sequences A0A175CJ41
gi|300173104|ref|YP_003772270.1| WP_013231479.1.38079 WP_013231479.1.48 WP_013231479.1.81830 WP_013231479.1.87361 WP_013231479.1.903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]