SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A175JQV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A175JQV5
Domain Number 1 Region: 2-270
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.92e-87
Family Capz alpha-1 subunit 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A175JQV5
Sequence length 270
Comment (tr|A0A175JQV5|A0A175JQV5_ENTHI) F-actin capping protein subunit alpha putative {ECO:0000313|EMBL:GAT95938.1} KW=Complete proteome OX=5759 OS=Entamoeba histolytica. GN=CL6EHI_033740 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MASESEKTKIVTTFLKDSPPGEFNNVLKDCREVVGDDSIFQECLPICLHDYNTEQLTVVM
DGTNPVIISKYTEQSAQEFIDPVNKKVVTFDHLSKQITSSQPLSSGLPGNDSLRQALQKK
LDNYAKEFYPKGAAIVMPKDNNTYTIIISAADLKVAQFSNGKWRSEWTISVGSKVTCEGR
IRVQVHYFEDANIQMHTDTKKKVTCNGGSEDQIAQNVIKEIKNIEDTFHAELDKIFATLS
DNCLKALRRQLPISRQKINWANWKGHKMMK
Download sequence
Identical sequences A0A175JQV5 C4M3N6
jCVI|EHI_033740 jCVI|EHI_140640 gi|56467292|gb|EAL45259.1| gi|56471235|gb|EAL48821.1| gi|67469333|ref|XP_650645.1| gi|67477497|ref|XP_654210.1| XP_650645.1.49425 XP_654210.1.49425 294381.C4M3N6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]