SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A176VF99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A176VF99
Domain Number 1 Region: 132-308
Classification Level Classification E-value
Superfamily MIR domain 1.44e-54
Family MIR domain 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A176VF99
Sequence length 321
Comment (tr|A0A176VF99|A0A176VF99_MARPO) Uncharacterized protein {ECO:0000313|EMBL:OAE19628.1} KW=Complete proteome; Reference proteome OX=1480154 OS=Marchantia polymorpha subsp. ruderalis. GN=AXG93_3756s1340 OC=Marchantia.
Sequence
MKGVNDRRVVDSVEWTRCEEGGKSVESSGVKSLTQRSRLVTGNSASGKERLELEQEAIRR
RDEHLRSVHQKKKKEKQEQGGLLTYKELTFWALSGLGFLAVMGFLIFGVLLMVGFMKPFE
DSGPQSAWAATGEGKEVTYGSVIKLQHDRTKYRLHSHEVPYGTGSGQQSVTGFPGGEDAN
SYWVVKPVSDSDARQGDLVSDGAIVRLFHTRTRKWLHSHLHASPITGNYEVSAFGADDQS
DTGDHWKLIIEGKGKVWLRDQKVRFLHVDTGGYLHSHDKKYSRIVAGQQEVCGYLKKNSD
NLWFAAEGVYFPSRNEGKASI
Download sequence
Identical sequences A0A176VF99

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]