SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A177AL55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A177AL55
Domain Number 1 Region: 60-324
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.31e-86
Family Capz alpha-1 subunit 0.00000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A177AL55
Sequence length 333
Comment (tr|A0A177AL55|A0A177AL55_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:OAF62003.1} KW=Complete proteome OX=655981 OS=Pseudogymnoascus destructans. GN=VC83_01504 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MTTGLTTEHPARPEVFSTLATSSPSPPFPRPDSNHAHAHLRHHRTRRARRPLQASEEEMA
SQLETVSAFVEGAPPGELGDVIADIKALTVESPELISQLGPAFEKYNEEQFATVKLPGGS
QQVIVSSHNSLGDGRYFDVENSSSFEFDHSTQKASNVQSYVLESANSDLIKSLIKSLAKH
AEDHYPNSSYGVYPIEDDSKIAILLVANKYSPNNFWNGRWRTLYILSPSPSSSSLVGSIK
VDVHYYEDGNVRLLTTKPVSLSVSSSTATSIVREIAVAEKKYQENLNKGFTSLSEGAFKG
LRRQLPVTRQKVEWDKIAGYRHGRGIAKSAEGF
Download sequence
Identical sequences A0A177AL55 L8FZ72
XP_012740404.1.62217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]