SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A177BA03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A177BA03
Domain Number 1 Region: 206-481
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.05e-62
Family Capz alpha-1 subunit 0.00000871
Further Details:      
 
Domain Number 2 Region: 15-90
Classification Level Classification E-value
Superfamily HMG-box 4.71e-20
Family HMG-box 0.001
Further Details:      
 
Domain Number 3 Region: 120-198
Classification Level Classification E-value
Superfamily HMG-box 0.000000000589
Family HMG-box 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A177BA03
Sequence length 482
Comment (tr|A0A177BA03|A0A177BA03_9METZ) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:OAF71137.1} KW=Complete proteome; Reference proteome OX=1819745 OS=Intoshia linei. GN=A3Q56_01094 OC=Eukaryota; Metazoa; Mesozoa; Orthonectida; Rhopaluridae; Intoshia.
Sequence
MICKFLINTLYRNFSKTINNIPKRPMMPFFIFRKEHFTEIKSDNPAMKSKDIMKKIGEKW
RTLNDEERNAYLKQYHELKLNYTFELSKMNPDILQLEKEKKIANNALKSLKKKKKNLENL
AIELNMPKRTVVNSFSVFIVEYKKKYPDTPLTFKAVSVEYNNLSNDEIERYKKIAKEAND
AYDRDIRKWVAEMRYIGNTQSYRNMNDETKIELIDDLIKHTPPGGLNYVLNDLREIVNDD
RILLSKAAPRSTAEYDRDQCIFVKVGNNEKYSMITNEAVYNNNYFDPRLCILFTYDHVNK
TCKTVQDNFVDNQNQQTLSLRNEIDDVVDEYVDSHHCDGNCVVYDLSGKSIIFKIYIMSQ
EISESNFRSGRWRSQFSVTLESLTSKSFVIKGAVRAHVHGYESGNFQLVSWHNKEEKIKL
GKKDSITSCIVNFIDKFESDYQESLNKEFNTISSTTFKALRRKLPVTKSLIDWQKIGAYN
IN
Download sequence
Identical sequences A0A177BA03

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]