SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A177BZ98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A177BZ98
Domain Number 1 Region: 5-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.31e-76
Family Capz alpha-1 subunit 0.00000513
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A177BZ98
Sequence length 271
Comment (tr|A0A177BZ98|A0A177BZ98_9PLEO) F-actin capping protein, alpha subunit {ECO:0000313|EMBL:OAG00039.1} KW=Complete proteome; Reference proteome OX=1460663 OS=Paraphaeosphaeria sporulosa. GN=CC84DRAFT_1129919 OC=Didymosphaeriaceae; Paraphaeosphaeria.
Sequence
MSRSQALSSFIESAPPGELGDVTKAIKNILGEDSVQSELEPAFQKHNEEQFALVKLPGSN
ENVIVSPYNSLGDGRYYDTENQSSFAYDHASLGGTASDVRSYAVESNHEELVKGLLKTLR
SHGTEHYPKYHIGVYPTSDDSQIALLTVASKYSPANYWNGRWRSSYLYTPSSATITGTIA
VDVHYYEDGNVRLLTNKTVNAKVSGSGAADVVKAIALAEKAYQEDLNKAFGGLAEGAFKS
LRRQLPITRQKIEWEKISGYRLGQDIGGGRR
Download sequence
Identical sequences A0A177BZ98
XP_018030404.1.78146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]