SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A177CMK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A177CMK8
Domain Number 1 Region: 2-257
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.53e-83
Family Capz beta-1 subunit 0.000000091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A177CMK8
Sequence length 260
Comment (tr|A0A177CMK8|A0A177CMK8_9PLEO) F-actin capping protein beta subunit {ECO:0000313|EMBL:OAG08784.1} KW=Complete proteome; Reference proteome OX=1460663 OS=Paraphaeosphaeria sporulosa. GN=CC84DRAFT_1141750 OC=Didymosphaeriaceae; Paraphaeosphaeria.
Sequence
MAEPIDSALDLLRRLNPKDVKQNVDNIIELNPSLEEELLESVDIPLSVKRCSSTKRDFLC
CDYNRDGDSWRSPWSNNFEPPIDEGITPSERIRKMEIKANEAFDVYRELYFEGGISSVYL
WDMDDGFAGCVLLKKSVKGGSWDSIHVFDAQDRARTAHYKLTSTVILSLGTESEALGGLD
LSGNMVRQVEQDMAVEDDGSHVANIGKMVEDMELKMRNLLQEVYFGKAKDVVGDLRSIPP
LSVTNRDRQTQREMISSMSR
Download sequence
Identical sequences A0A177CMK8
XP_018039149.1.78146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]