SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A177D755 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A177D755
Domain Number 1 Region: 24-121
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 3.27e-33
Family VPS28 N-terminal domain 0.00067
Further Details:      
 
Domain Number 2 Region: 141-233
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 1.7e-30
Family VPS28 C-terminal domain-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A177D755
Sequence length 236
Comment (tr|A0A177D755|A0A177D755_ALTAL) ESCRT-I complex subunit VPS28 {ECO:0000256|PIRNR:PIRNR017535} KW=Complete proteome; Reference proteome OX=5599 OS=Alternaria alternata (Alternaria rot fungus) (Torula alternata). GN=CC77DRAFT_1025345 OC=Pleosporaceae; Alternaria; Alternaria alternata group.
Sequence
MSYGGRQLAYAPTPYIPRSNLSATINLDEEVKLSATNAERDLNDSLAEIYSIIITLDAIE
KAYLKDSIAEADYTETCNRLMKQYKSNLANETVAQAFGTLDQFAKEWQMECPRAIERLRV
GIPATIEQGPSRPTQGGDFADATLVVNATETFITLLDAIKIGLVEKDTLHPLLVEIIQAV
NKVTDVDFESKGKIVQWLITLNQMRAAEKLSDEQAREFQFDMDSAYYGFKTTLKKA
Download sequence
Identical sequences A0A177D755
XP_018380431.1.3594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]