SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A177TMJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A177TMJ3
Domain Number 1 Region: 12-170,273-435
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.7e-54
Family Capz alpha-1 subunit 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A177TMJ3
Sequence length 442
Comment (tr|A0A177TMJ3|A0A177TMJ3_9BASI) Uncharacterized protein {ECO:0000313|EMBL:OAJ03782.1} KW=Complete proteome OX=43049 OS=Tilletia indica. GN=A4X13_g3874 OC=Exobasidiomycetes; Tilletiales; Tilletiaceae; Tilletia.
Sequence
MSTAEEAPPTADQRASLAAGLLLQTPPGQIASVYSDLSSILLSTLPEGSTQASAAEEATL
FQAHATRALESYNTDQLVPFRLPGSERTTLICRAAQLASSTGQQGQPTAALPRYTDPSTS
QSFAFDHFKLTASDIQPHPSNPEHEPLRLALQAGVDAYLANHFPDGVGAVFVVYPPPSAS
AIAEAASSSAAAASAAPSEEVAQAAEEAVSESKADGPDDAVGAVEATEAVEADQKESDDA
APPEAEAAQVAGTEEETEAQMSSESEAAAAPKPRPEWAGPPSYIIHITGNRFNPQNFWAG
RWRSSYTYTPRTSANPSPAETDIDASPLGTLRAHIALHVHYYEDGNVQLHLGSPKDSAFL
PLPSSVPSSDPEKEKAALSNLLFSIIGKHEEVFQRELGEVLSEQFAEKAMRSLRRALPIT
RQRVDWDKLVNYKLGSELGRAS
Download sequence
Identical sequences A0A177TMJ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]