SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A177UT53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A177UT53
Domain Number 1 Region: 6-288
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.83e-65
Family Capz beta-1 subunit 0.000000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A177UT53
Sequence length 297
Comment (tr|A0A177UT53|A0A177UT53_9BASI) Uncharacterized protein {ECO:0000313|EMBL:OAJ18435.1} KW=Complete proteome OX=13290 OS=Tilletia caries (wheat bunt fungus). GN=A4X03_g4921 OC=Exobasidiomycetes; Tilletiales; Tilletiaceae; Tilletia.
Sequence
MASLAEALDLFRRLPPSQLPENLQTLFAISPDLEDELSCSVDQPLLIRHDNTPEGKGREF
LCCQFNMDAGSWRSPWSSTYDPPIGTSTAEGDDGEPEEDGAQPSPQLRELEIKANEAFAT
YKQMYFEGGLSSVYLWNQDEAETSIAGVVLIRKDVDDGPGPSSTWSSMHVFETNTEKGSK
YAEYKLTSTVMLSVARKGDAKLGDLELSGSLTRQDAAKYEVPNMASHIGNVGRLIENQEA
KIRGLLQEVYFGKMRDIVGSLRSIESLAESKRQQNLQRELMGLMMKKQAAATPAATT
Download sequence
Identical sequences A0A177UT53 A0A177VTQ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]