SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A177VY58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A177VY58
Domain Number 1 Region: 30-200
Classification Level Classification E-value
Superfamily MIR domain 1.44e-40
Family MIR domain 0.0000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A177VY58
Sequence length 211
Comment (tr|A0A177VY58|A0A177VY58_BATDE) Uncharacterized protein {ECO:0000313|EMBL:OAJ32763.1} KW=Complete proteome; Reference proteome OX=403673 OS=Batrachochytrium dendrobatidis JEL423. GN=BDEG_28644 OC=Rhizophydiales incertae sedis; Batrachochytrium.
Sequence
MLIVFLTIAIIIARVASASEPFIIDKEFAAVTCGSGIKLVNKATGARLHSHEVHYGSGSG
RQSVTGYPKGDDPNSLFVVGAALSGSCSRGQPVHCGDSIRLQHLNTRQYLHSQSGIQSPM
SKNQEVSGHDQPGTGDNWIVQCLDSKEKLWGRERNIKLVHANTKHFLGTSSRFSFQNVIT
GQLEVSARSGKNGDEEIWSVQEGVFFATAAS
Download sequence
Identical sequences A0A177VY58 F4P9I5
BDET_08696 jgi|Batde5|26916|fgenesh1_pg.C_scaffold_11000171 XP_006681087.1.45406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]