SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A177WTB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A177WTB3
Domain Number 1 Region: 4-215
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.19e-46
Family Capz alpha-1 subunit 0.0000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A177WTB3
Sequence length 219
Comment (tr|A0A177WTB3|A0A177WTB3_BATDE) Uncharacterized protein {ECO:0000313|EMBL:OAJ42865.1} KW=Complete proteome; Reference proteome OX=403673 OS=Batrachochytrium dendrobatidis JEL423. GN=BDEG_26265 OC=Rhizophydiales incertae sedis; Batrachochytrium.
Sequence
MTATDAEKLEIVSGFIKDSPPGEINDVFNGRLILIQYSVHLYSLSFILDNVRSLVADDSL
LQNTIESTFADHHAKQLVSVQVPSKDYEVILGEYGCIEPSKYVDPRSGQALIVDLVHQTV
KSVEPYHSKCSAHLLDQRAALDVAVQEYTASFYPSSVCTVWATEDEALVIAIVANKYHPD
SFWSGRWRSLWRLEPKSSMLTGSAKVQVHYYEDGKCSAQ
Download sequence
Identical sequences A0A177WTB3
BDET_06306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]