SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A178BV55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A178BV55
Domain Number 1 Region: 23-126
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 4.84e-26
Family Steroid-binding domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A178BV55
Sequence length 134
Comment (tr|A0A178BV55|A0A178BV55_9EURO) Uncharacterized protein {ECO:0000313|EMBL:OAL20573.1} KW=Complete proteome OX=979981 OS=Fonsecaea multimorphosa. GN=AYO22_08582 OC=Fonsecaea.
Sequence
MTDPTSPSPYSENKKFEPKVPVELEPPKNQEISLEELSQCDGTNPDKPTWVAIKGTVFDV
SKNKAYGEKGQYHVFAGKDPSRALALSSLKPEDCVPEWDDLDDKYKTVLDEWYTFFSKRY
NIVGKVSISKIQKL
Download sequence
Identical sequences A0A0D2JNN5 A0A178BV55
XP_016629045.1.52555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]