SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A178F1X5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A178F1X5
Domain Number 1 Region: 2-217
Classification Level Classification E-value
Superfamily 14-3-3 protein 5.49e-95
Family 14-3-3 protein 0.0000000474
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A178F1X5
Sequence length 268
Comment (tr|A0A178F1X5|A0A178F1X5_TRIRU) 14-3-3-like protein {ECO:0000313|EMBL:OAL66249.1} OX=5551 OS=Trichophyton rubrum (Athlete's foot fungus) (Epidermophyton rubrum). GN=A7C99_3357 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MVTYMKEVASLGGELSVDERNLLSVAYKNVVGTRRASWRIISSIEQKEESKGSEKHVQAI
SEYRQKIEQELERVCQDVLDVLDQSLIPKAESGESKVFYHKMKGDYHRYLAEFASGNKRK
NAVTAAHDAYKNATDVAQTELTSTHPIRLGLALNFSVFYYEILNSPDRACHLAKQAFDDA
IAELESLSEESYRDSTLIMQLLRDNLTLWTSSESGEPEPNMPQGQQAPTEGATEEKKTEE
APADDAAAKTEEPAAATEAKKEEPAAES
Download sequence
Identical sequences A0A022VVN7 A0A022XLK4 A0A080WKT0 A0A178F1X5 A0A178FDE3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]