SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A178UV34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A178UV34
Domain Number 1 Region: 194-278
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 1e-27
Family SWIB/MDM2 domain 0.0014
Further Details:      
 
Domain Number 2 Region: 302-383
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 6.05e-20
Family SWIB/MDM2 domain 0.0024
Further Details:      
 
Domain Number 3 Region: 3-56
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.0000366
Family DEK C-terminal domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A178UV34
Sequence length 385
Comment (tr|A0A178UV34|A0A178UV34_ARATH) Uncharacterized protein {ECO:0000313|EMBL:OAO96581.1} KW=Complete proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=AXX17_At4g26000 OC=Arabidopsis.
Sequence
MVSDQDLAKGVETLLRQSDPSSLTSLSSIVQQLEAKLGLDLTEKTTFIRDQINILLRAHQ
NPSASVASASSVQQSHPPPPPSSHQQQNLHSGVNVPPMAKGHFTLSHPSQFSVSSQSQQY
PSHFALQPPYHSYDLNFRQPYPVYMPPQQHQHQQQSPRQQQSSVMLSHGGNASLSVNQAP
KESAPAGTKRKGGPGGLNKVCRVSPELEVVVGEPALPRTEIVRQLWAYIRKNNLQDPSNK
RKIICDDALRVVFETDCTDMFKMNKLLAKHILPLDPSKDSGQAKKAKTEVETKTETTEPV
SSTAISSTVTLSEPLGKFFGTGETEMADEEIIRRVWEYIKLNNLEDPVNPMAIQCDEKLR
DLLGCESISAVGINEMLRRHMYKQS
Download sequence
Identical sequences A0A178UV34 Q8LFA6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]