SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A178WKY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A178WKY0
Domain Number 1 Region: 2-245
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.19e-72
Family Capz beta-1 subunit 0.000000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A178WKY0
Sequence length 256
Comment (tr|A0A178WKY0|A0A178WKY0_ARATH) CPB {ECO:0000313|EMBL:OAP18846.1} KW=Complete proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=AXX17_At1g65910 OC=Arabidopsis.
Sequence
MEAALGLLRRMPPKQSETALSALLSLIPQHSSDLLSQVDLPLQVLRDIESGKDFILCEYN
RDADSYRSPWSNKYLPPLEDALYPSSELRKLEVEANDIFAIYRDQYYEGGISSVYMWEDD
NEGFVACFLIKKDGSKSGHGRRGCLEEGAWDAIHVIQVGSEEEEMAQYCLTSTIMLSLTT
DDESSGKFGLSGSIRRQMKMELAVADGHLCNMGRMIEELEGKLRNSLDQVYFGKTREMVC
TLRPPAEIVQMRLPDT
Download sequence
Identical sequences A0A178WKY0 Q9M9G7
AT1G71790.1 AT1G71790.1 3702.AT1G71790.1-P NP_177324.2.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]