SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A178ZXW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A178ZXW9
Domain Number 1 Region: 4-269
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.05e-79
Family Capz beta-1 subunit 0.0000000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A178ZXW9
Sequence length 273
Comment (tr|A0A178ZXW9|A0A178ZXW9_9EURO) F-actin-capping protein subunit beta {ECO:0000313|EMBL:OAP64547.1} KW=Complete proteome; Reference proteome OX=1367422 OS=Fonsecaea erecta. GN=AYL99_00519 OC=Fonsecaea.
Sequence
MASEAQFDAALDLLRRLSPLKVSDNLTSITALVPDLTEDLLSSVDQPLTSARCKKTGRDY
LLCDYNRDGDSYRSPWSNEFEPPLDDATYPSDRVRKMEVEANTAFDVYRQMYYEGGTGSV
YLWDLDDGFAGVVLLKKAVGKEAGWDSIHVFEVDERRGSGRTCHYKLTSTVILHLGRDSE
GLGSLNLSGSMTRQVEADLVVENVGGQGKDGGHVCNAGRLIEDMEGKMRNMLQEVYFGKA
KDVVGDLRSVAPLTGVNRERQAQRDVISSMGGK
Download sequence
Identical sequences A0A178ZXW9
XP_018697914.1.100146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]