SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A179I8H0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A179I8H0
Domain Number 1 Region: 7-88
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.42e-19
Family Capz beta-1 subunit 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A179I8H0
Sequence length 90
Comment (tr|A0A179I8H0|A0A179I8H0_CORDF) Uncharacterized protein {ECO:0000313|EMBL:OAQ98977.1} OX=1105325 OS=Cordyceps confragosa (Lecanicillium lecanii). GN=LLEC1_07576 OC=Cordyceps.
Sequence
SASAALGELDLSGNMTRQVEQDLPVDTDESHIANVGKLVEDMELKMRNLLQEVYFGKAKD
VVGDLRSAGSLSDGARDRETQREIIGSMRR
Download sequence
Identical sequences A0A179I8H0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]