SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A179I976 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A179I976
Domain Number 1 Region: 398-643
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.23e-81
Family Capz alpha-1 subunit 0.00000754
Further Details:      
 
Domain Number 2 Region: 71-257
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.94e-63
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000455
Further Details:      
 
Domain Number 3 Region: 263-389
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.7e-31
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A179I976
Sequence length 652
Comment (tr|A0A179I976|A0A179I976_CORDF) Uncharacterized protein {ECO:0000313|EMBL:OAQ98832.1} OX=1105325 OS=Cordyceps confragosa (Lecanicillium lecanii). GN=LLEC1_05742 OC=Cordyceps.
Sequence
MKRQVARQFRRCLQMPRLPVAALSLHASRCYSTHPPNAKLNLPVEYGSTPLLAHSADAVL
KNLEIPAEVRNGATKKLNLFQAVNDALGTALAEDESVVVFGEDVAFGGVFRCTMKLAETH
GAERVFNTPLSEQGILGFGIGLAAEGMRPVAEIQFADYVYPAFDQIVNEAAKMRFRDGSN
GRGAGGLTVRMPCGGVGHGALYHSQSPESLFTHVPGIRVIMPRSPIQAKGLLLSAIRSND
PCIFMEPKILYRAAVEQVPVASYELPLSKAEVLKEGSNVTVISYGQPLYYCIEAIRQLEA
QRPDVSIELIDLRTVHPFDRETVFESVKKTGRVMIVHEAYTTASVGSEVAAAVQENPETF
NRLEAPVRRVAGWDIHNSLAFERFHLPDITTNLRLSQQLADVVADIKTLTASSPNLLSQL
GPAFQKYNEDQLVTVKLPGSSESVLVSEHNSLGEGRYYDVESSSSFEFDHATQKASAVQS
HTFEGAQADLTRSTLKSLSTYISEHFPNAAYGVYPIESDSKIAIVIVANKYSPNNFWNGR
WRSVYTFDPSSGSLEGTIKVDVHYYEDGNVRLQTKKPVSVSVASSTGAGIAKEISSTERK
YQEELNKGFVSLSEGAFKGLRRQLPVTRQKIEWDKVTGYRLGQDIGGGSSKR
Download sequence
Identical sequences A0A179I976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]