SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A179UD79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A179UD79
Domain Number 1 Region: 4-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.35e-85
Family Capz alpha-1 subunit 0.00000804
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A179UD79
Sequence length 318
Comment (tr|A0A179UD79|A0A179UD79_BLAGS) Capping protein (Actin filament) muscle Z-line, alpha {ECO:0000313|EMBL:OAT05790.1} KW=Complete proteome; Reference proteome OX=559298 OS=Blastomyces gilchristii (strain SLH14081) (Blastomyces dermatitidis). GN=BDBG_02120 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Blastomyces.
Sequence
MPSNLEIASSFIRGAPPGELSDVVADIKALTPEGPSLISSLTPAFENYNEEQLATVKLPG
GSENVIVSAYNKLDGNRYYDVESQTSFEFDHVTQTASSPQSYVLESQHSDLIKSLLKSLS
THAREHYPSCSYGVYPTDNDSAAAILLVANKYSPNNFWNGRYRAIYTVPIPSADTITGTI
HINVHYYEDGNVSLNTTKPVSISLSPNSSADTIIKRIAAAERAQQLELSDAFSRLSEGAF
KGLRRQLPITRQKVEWEKVGGYRLGQDISGGKDNVTKLFDYDLPGTLFELFLLLPAGNCT
NENASDLSFTSENSSGIR
Download sequence
Identical sequences A0A179UD79

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]