SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A179UYD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A179UYD0
Domain Number 1 Region: 26-122
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 1.28e-33
Family VPS28 N-terminal domain 0.00064
Further Details:      
 
Domain Number 2 Region: 147-238
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 2.22e-32
Family VPS28 C-terminal domain-like 0.0000918
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A179UYD0
Sequence length 239
Comment (tr|A0A179UYD0|A0A179UYD0_BLAGS) ESCRT-I complex subunit VPS28 {ECO:0000256|PIRNR:PIRNR017535} KW=Complete proteome; Reference proteome OX=559298 OS=Blastomyces gilchristii (strain SLH14081) (Blastomyces dermatitidis). GN=BDBG_07595 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Blastomyces.
Sequence
MYQQRPLSYAPTPYSYTPNTALSASINLDEEVKLSSTSAERDLYESLAEIYSIILTLDGL
EKAYIKDAITESEYTETCARLLKQYKSSLSDETVAKEFVDLDTFRQTWGLECPRATERLR
IGVPVTVEQASHSAAPVPSGTGTNTSGSLILAATENFITFLDALKLNMVSKDALHPLLSE
IIQSVNRVTDQDFENRGKIIQWLIALNQMRATEELSEDQARELAFEIEQAYQGFKDTLS
Download sequence
Identical sequences A0A179UYD0 C5GM27 F2TR55 T5BNL4
BDBG_07595T0 XP_002622193.1.14838 BDCG_04740T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]