SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A181DA40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A181DA40
Domain Number - Region: 6-31
Classification Level Classification E-value
Superfamily Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor 0.0575
Family Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A181DA40
Sequence length 32
Comment (tr|A0A181DA40|A0A181DA40_9ENTR) Uncharacterized protein {ECO:0000313|EMBL:SAZ49498.1} KW=Complete proteome OX=208224 OS=Enterobacter kobei. GN=SAMEA3181516_03593 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MTALKKHIGRWSDVYLYLAVVAYLMWLAAVIS
Download sequence
Identical sequences A0A156HCR1 A0A181DA40

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]