SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182AP82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182AP82
Domain Number 1 Region: 13-77
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.000000126
Family HEPN domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A182AP82
Sequence length 103
Comment (tr|A0A182AP82|A0A182AP82_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:SBO43402.1} KW=Complete proteome OX=1851505 OS=Cyanobium sp. NIES-981. GN=CBM981_1691 OC=Bacteria; Cyanobacteria; Synechococcales; Synechococcaceae; Cyanobium.
Sequence
MLDPDLFDEATWGFHVQQATEKALKAWMSALERDYPRTHDLALLGQLIIDGGGDPTPFQS
LENFTPFGARLRYDDEPEVLNLDRAAWNQLCADLLEQVASLIP
Download sequence
Identical sequences A0A182AP82

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]