SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A182F4G2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182F4G2
Domain Number 1 Region: 52-316
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-95
Family Capz beta-1 subunit 0.00000000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A182F4G2
Sequence length 324
Comment (tr|A0A182F4G2|A0A182F4G2_ANOAL) Uncharacterized protein {ECO:0000313|VectorBase:AALB001352-PA} KW=Complete proteome; Reference proteome OX=7167 OS=Anopheles albimanus (New world malaria mosquito). GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
EEDRSAIGIAPAAKGHANKPNRPLAFATFTNNTPTYRIRGHPRLPGLHSWTEQQMDCALD
LMRRLPPQQIEKNLIDLIDLAPALCEDLLTSVDQPLKIAKDKETGKDYLLCDYNRDGDSY
RSPWSNTYDPPLEDGSMPSERLRKLEIEANHAFDQYREMYYEGGVSSAYLWDLDHGFAGV
ILIKKAGEGNQKTKGCWDSIHVVEVQEKSSGRTAHYKLTSTAMLWLQTTKQASGTINLGG
SLTRQIEQDAPVSESSPHIANIGRIVEDMENKIRNTLNEIYFGKTKDIVNGLRSIQSLSD
ANQQATMKHDLAAALLRRTGKSEN
Download sequence
Identical sequences A0A182F4G2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]