SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A182FDY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182FDY1
Domain Number 1 Region: 241-427
Classification Level Classification E-value
Superfamily MIR domain 3.31e-58
Family MIR domain 0.000000177
Further Details:      
 
Domain Number 2 Region: 428-598
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.01e-50
Family IP3 receptor type 1 binding core, domain 2 0.000000507
Further Details:      
 
Domain Number 3 Region: 1463-1576
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.09e-35
Family IP3 receptor type 1 binding core, domain 2 0.0048
Further Details:      
 
Domain Number 4 Region: 108-194
Classification Level Classification E-value
Superfamily MIR domain 0.0000000000000327
Family MIR domain 0.019
Further Details:      
 
Domain Number 5 Region: 1566-1596,1673-1733,1769-1843,1943-1971,2008-2030,2176-2220,2320-2469
Classification Level Classification E-value
Superfamily ARM repeat 0.0000875
Family Armadillo repeat 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A182FDY1
Sequence length 3200
Comment (tr|A0A182FDY1|A0A182FDY1_ANOAL) Uncharacterized protein {ECO:0000313|VectorBase:AALB004722-PA} KW=Complete proteome; Reference proteome OX=7167 OS=Anopheles albimanus (New world malaria mosquito). GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MGDSTMGSVSFLHLGDIVSLYSEGSVSGFLSTLGLVDDRVVVCPGAGDLNDPPEKFRDCL
IKICPMNRYSAQKQFWKAAKQSTTTNTDTSLLKRLHHAAEIEKKQNESENKKLLGTVVQY
GSVVQLLHLKSNKYVTVNIRLPALLEKNAMRVYLDANGNEGSWFYIMPFYKLRSAGDNVV
VSDKVILKPVNANRQNLHVAATYELPDNPGSKEVNVLNSSTSWKITLFMEQRENQEDVLK
GGDVVRLFHAEQEKFLTMDEYKKHQHVFLRTTGRSSATAATSSKALWEVEVVQHDSCRGG
AGHWNSLFRFKHLATGYYLAAEIDEDISRTEKSSSSSHPAGGDSFRLVPVPHSTDIASVF
ELDSTTITRPEGLVPQSSYVRLRHLCSNTWVHATSVPIDIDDDKPVMSKVGCSAIKEDKE
AFQLIPVSPVEVRDLDFANDACKLLLAMSTKLENGTISSNERRSLIALLQDIVFFIAGQE
NDQNKSDALDLTINNPNRDRQKLLREQYILKQLFKILQGPFQETKTNDGPFLRIDELGDP
KNAPFKNIFRLCYRILKLSQQDYRKNQEYIAKHFGLMQKQIGYDILAEDTITALLHNNRK
LLEKHITAAEIETFVGLVRKNMQSWQSRFLDYLSDLCVSNKKAIAVTQELICKSVLSAKN
ADILIETFLREVDDDPLGYLSELERGNREFTEIREVDESVTAGGDGAGQGTDGGKRKLDE
KKRYEVVLMWQNRTQSKSMSRLAQGLKIGRTTDIAILDYYRHQLNLFSNMCLNRQYLALN
NLSPHLDIDLILRCMSDKTVPYDLRASFCRLMLHLHVDRDPQEPVTPVKYARLWSEIPTV
MSINDYDIEKQVDSNKEAVRARFNKTIAFVEDYLCNHVVSKMWFADQDQNKLTFEVVKLA
RDLIYFGFYSFSDLLRLTKTLLNILDCVSSSEADGTGLPTGHIDSEGKEPTPAPAIAVTG
EEAASAAGKAVDVAGKQDAPETIGHPSAGAEGKRTSEFGMPQKFNRSASTVAVLAAIEAT
KTSKFRSGSIPEVSTGGGAGNGTSGNGGSGAEGGVLRRIGDMGAVMTSLTLGPISTSIVA
PTIQHRKSVSQLMKEYPLVMDTKLKIIEILQFILDVRLDYRISCLLSIFKREFDENEQTA
STAATAQPTAQFIAPPTVIAPTEAPATGDPSADASQPTDANSSAGDTASEVSLTLSNTTT
ELTTSTTTTGSDSTSEGLGTMSSDASADATTTVKPPPTSSSSSSEAKAHGAGHAPPTAEN
INLRQKNIDLESIGYQAEGIFGCTEDTYNPLDLDGQGGRTFLRVLLHLIMHEYPALVSGA
LHLLFRHFSQRHEVLHAFRQVQLLVSDSDVESYKQIKSDLDVLRQSVEKSELWVYKSKQT
DDLLAGGGEGGDGADGGGAGGTSGGSKGAGEHGGSEGSAGGGGGGGIGKAGTGSGSTSKG
KPELVKQESQLNFDQGPELNAEQSLEYKKIQQILIRMNKLCVTPTGPDGFVKPRKHEQRL
LRNVGVHTVVLDLLQIPYDEKDDYRMNELMRLAHQFLQNFCLGNQQNQILLHKQLDLFLN
PGILEAETVCSIFKDNLNLCNEVSDKVVQHFVHCIEIHGRHVEYLKFLQTIIKAENQFIR
KCQDMVMQELVNAGEEVLVFYNDKSSFNYFVEQMRSYSGGTLADPSPLMYHIELVKLLAC
CTMGKNVYTEIKCNSLLALDDIVAMISHPDCIPEVKVAYVDFLCHCYIDTEVEVKEIYSS
NHMWCLFEKSFLIDINNVVKGGSFTNRQLENYVCNEVMNILTTFFNSQFSDQSTALQRSI
DKTMPPGEEEDGEGTNKEWEAQLNRILSAQRYRAKKLLRQSSLNEKRQLIFVKILQNSFK
LTQCKWLSPSQRFNVENCIRTLSEKAKPRGIAIPIDLENQVVKMFNKTAMLSRQTSKWLL
VTKQTKMERSQSQIMRMDRSIIEGLQDIVSLLEDKLKPLVEAEQSLLVDILYRSELLFPL
NTESRKKCETGDFIRHLIKHTEKLLEEKEEKLCVKILKTLKEMMTIDCDYGDKGDHLRTI
LLKRYFGHEFSLQPSTAATAAVGVAGLPGAVGTVASSVHVALLQPAIVGGTGAGTASSPM
ASVSHGPGAKYLFRAGRTLHEVQNHLDKEGASDLVIELVIKSINSPSIFVEAIELGIALL
EGGNPIIQKGMYNKFLSNDLSQSFFKVFFDKMKDSQQEIKSTVTVNTSDMAANKASESKV
EGKDHDKIGQRKSLNKVNGIVITEDFKEELQNAALLTQQSYINARSLATTSSADGTGSDN
GDESSLMSIGSSALEDILAEKLEKHKDKDENNKLSNKVLVMQPILRFLQLLCENHNPELQ
NLLRNQNNKTNYNLVSETLMFLDCICGSTTGGLGLLGLYINENNVSLINQTLETLTEYCQ
GPCHDNQNCIATHESNGLDIITALILNDINPLGKNRMDLVLELKNNASKLLLAIMESRGD
SENAERILANMNPKQLVDVACRAYHQDENILMLLNQSEGSGGTGGSGGMGGGGGGGSGAS
GDGDGYGSLRPDLGDDGHDDDDVGVSPKEVGHNIYILCHQLAQHNKELAGLLKIDTYSTA
TPATGGGAGGLAAVAASTAAATAAATAASKANSKTNQALLYYQTHTAQIEIVRHDRTLEQ
IVFPIPEICEYLTKDTKVRVLNTAERDDQGSKVADFFDRHEAMFNEMKWQKKLRGQPALF
WVSSYMSLWSNILFNLAVLINLIVAFFYPFENAVPELSFHLSSLIWIVMLVSLAIVITLP
RQSGIRTFVVALILRLIFSCGPEPTLWLLGCITVVMKGVHIISLMGNYGTLEKHLFSILT
DAELLYHFFYLLFCVFGVLLHPFFFSILLFDVVYREETLLNVIRSVTRNGRSIILTAVLA
LILVYMFSIIGYMFFRDDFLVPVDEEYSPPAAPSPLPDGMDCAAGESGVAVGGAGHMVSA
GPDIVGQVVQQTCSRGEQAGTVGGADTGGDGEMKERGCDSMIMCIITTMNQGLRNGGGIG
DILRAPSRKETLFVPRVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQQKELILKNT
CFICGLNRSAFDNKTVSFEEHIKNEHNMWHYLYFIVLVKVKDPTEFTGPESYVHAMVKAN
IQDWFPRLRAMSLAAVDGDGEQIELRSLKNLLETNHVAVRELMAQIMELENKMTEQRKQR
QRHALLNPTTSTSYQFYPQL
Download sequence
Identical sequences A0A182FDY1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]