SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182LEY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182LEY3
Domain Number 1 Region: 64-186
Classification Level Classification E-value
Superfamily Actin-crosslinking proteins 1.14e-23
Family Fascin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A182LEY3
Sequence length 262
Comment (tr|A0A182LEY3|A0A182LEY3_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:ACOM036885-PA} KW=Complete proteome; Reference proteome OX=1518534 OS=Anopheles coluzzii. GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MSEYNKAKISKLVLKGESSKGTKRKHKKDKKDKEAKRALVVDTDAVKHGGWWQVAKTSDI
TGSIALQFDKQAYVKALDNGLFTLGAPHNEGDPPDPEEIFSAVLINEQKVAFKSGYGKYL
KVEKDGMITGRSDAVSALEQFEPVFEQGKTALLAANGCFVSVDPEDDALVAVKKKVGSDE
VCTIRSCAGREDISSKELPVEESGDLDQVELNYVKKFQKFQDKKIRVSKEDKLTLKKAKE
DGALHEALLDRRSKMKADRYCK
Download sequence
Identical sequences A0A182LEY3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]