SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A182LKU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182LKU8
Domain Number 1 Region: 241-427
Classification Level Classification E-value
Superfamily MIR domain 2.09e-58
Family MIR domain 0.000000181
Further Details:      
 
Domain Number 2 Region: 428-598
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.27e-50
Family IP3 receptor type 1 binding core, domain 2 0.000000528
Further Details:      
 
Domain Number 3 Region: 1264-1291,1341-1454
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 3.27e-36
Family IP3 receptor type 1 binding core, domain 2 0.0045
Further Details:      
 
Domain Number 4 Region: 108-193
Classification Level Classification E-value
Superfamily MIR domain 0.0000000000000379
Family MIR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A182LKU8
Sequence length 2989
Comment (tr|A0A182LKU8|A0A182LKU8_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:ACOM039669-PA} KW=Complete proteome; Reference proteome OX=1518534 OS=Anopheles coluzzii. GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MGDSTIGSVSFLHLGDIVSLYSEGSVSGFLSTLGLVDDRVVVCPGAGDLNEPPEKFRDCL
IKICPMNRYSAQKQFWKAAKQSTTTNTDTSLLKRLHHAAEIEKKQNESENKKLLGTVVQY
GSVVQLLHLKSNKYVTVNIRLPALLEKNAMRVYLDANGNEGSWFYIMPFYKLRSAGDNVV
VSDKVILKPVNANRQNLHVAVTYELPDNPGSKEVNVLNSSTSWKITLFMEQRENQEDVLK
GGDVVRLFHAEQEKFLTMDEYKKQQHVFLRTTGRSSATAATSSKALWEVEVVQHDSCRGG
AGHWNSLFRFKHLATGYYLAAEIDEDISRTEKSSSSSHPQGGDSFRLVPVPHSSDIASVF
ELDSTTITRPEGLVPQSSYVRLRHLCSSTWVHATSVPIDIDDDKPVMSKVGCSAIKEDKE
AFQLIPVSPVEVRDLDFANDACKLLLAMSTKLENGTISSNERRSLIALLQDIVFFIAGQE
NDQNKSDALDLTINNPNRDRQKLLREQYILKQLFKILQGPFQETKNNDGPFLKIDELGDP
KNAPFKNIFRLCYRILKLSQQDYRKNQEYIAKHFGLMQKQIGYDILAEDTITALLHNNRK
LLEKHITAAEIETFVGLVRKNMQSWQSRFLDYLSDLCVSNKKAIAVTQELICKSVLSSKN
ADILIETFLREVDDDPLGYLSELERGNREFTEIREVDESSSGVEGDSKGTTNGKRKLDEK
KRYEVVLMWTNRTQSKSMSRLAQGLKIGRAVDTAILDYYRHQLNLFSNMCLNRQYLALNN
LSPHLDIDLILRCMSDKTVPYDLRASFCRLMLHLHVDRDPQEPVTPVKYARLWSEIPTVM
SINDYDIEKQLDSNKEAVRARFNKTIAFVEDYLCNHVVSKMWFADQDQNKLTFEVVKLAR
DLIYFGFYSFSDLLRLTKTLLNILDCVSSSEADGTGLPTGHIDSEGGVLRRIGDMGAVMT
SLTLGPISTAIVSPTIQHRKSVSQLMKEYPLVMDTKLKIIEILQFILDVRLDYRISCLLS
IFKREFDENEQTASTGAALAPPTVIVPETPTIIPPGGGGVPSTTNDATSPAVSVVVPPAD
SVSQDANSSMGGDTTSEVSLTLSNTTVESTTTTNASDSTSEGHGTMSSEGGTSMTDGLSS
SGGSKATDTSLPPTAENINLRQKNIDLESIGYQAEGIFGCTEDTYNPLDLDGQGGRTFLR
VLLHLIMHEYPALVSGALHLLFRHFSQRHEVLHAFRQVQLLVSDSDVESYKQIKSDLDVL
RQSVEKSELWVYKSKQTDDLLAGGGGEGGEGGDGSGGKGGEQGEGGAGGGGKSASAKGKP
ELVKQESQLNFDQGPELNPEQSQEYKKIQQILIRMNKLCITATGPDGFVKPRKHEQRLLR
NVGVHTVVLDLLQIPYDEKDDYRMNELMRLAHEFLQNFCLGNQQNQILLHKQLDLFLNPG
ILEAETVCAIFKDNLNLCNEVSDKVVQHFVHCIEIHGRHVEYLKFLQTIIKAENQFIRKC
QDMVMQELVNAGEEVLVFYNDKGSFNYFVELMRSYSAGTLADPSPLMYHIELVKLLACCT
MGKNVYTEIKCNSLLALDDIVAMISHPDCIPEVKVAYVDFLCHCYIDTEVEVKEIYSSNH
MWCLFEKSFLIDINNVVKGGSFTNKQLENYVCNEVMNILTTFFNSQFSDQSTALQKRQLI
FVKILQNSFKLTQCKGLTPSQRFNVENCIRTLSEKAKPRGIAIPIDLENQVVKMFNKTAM
LSRQTSKWLLVTKQTKMERSQSQIMRMDRSIIEGLQDIVSLLEDKLKPLVEAEQSLLVDI
LYRSELLFPLNTESRKKCETGDFIRHLIKHTEKLLEEKEEKLCVKILKTLKEMMTIDCDY
GDKGDHLRTILLKRYFGNDFTLQAPVAALPGAVGPAVLQPANVSTAVGSPMASVSHGPGA
KYLIRAGRTLHEVQNHLDKEGASDLVIELVIKSINSPSIFVEAIELGIALLEGGNPIIQK
GMYNKFLSNDLSQSFFKVFFDKMKDAQQEIKSTVTVNTSDMAANKASESKVEGKDLDKIG
QRKNVNKVNGIVITEDFKEELQNAALMTQQSYINARNLAAASDGTGSDNGDENSLMSIGS
SALEDILAEKLEKHKDKDENNKLSNKVLVMQPILRFLQLLCENHNPELQNLLRNQNNKTN
YNLVSETLMFSGLYLRLDDGWAGIVGVNNVSLINQTLETLTEYCQGPCHDNQNCIATHES
NGLDIITALILNDINPLGKNRMDLVLELKNNASKLLLAIMESRGDSENAERILANMNPKQ
LVEVACRAYHQDENILMLLNQSDGGGGGSGVGGGGGRGGGGVDDGYGGLRHDLGDDGHDD
DDVGVSPKEVGHNIYILCHQLAQHNKELAGLLKIDTYNGSGTAGSNAAPIVPTFPGANPS
SLGGGPPSSASANSAASKANSKTNQALLYYQTHTAQIEIVRHDRTLEQIVFPIPEICEYL
TKDTKVRVLNTAERDDQGSKVADFFDRHEAMFNEMKWQKKLRGQPALFWVSSYMSLWSNI
LFNLAVLINLIVAFFYPFENALPELSFHLSSLIWIVMLVSLAIVITLPRQSGIRTFVVAL
ILRLIFSCGPEPTLWLLGCITVIMKGVHIISLMGNYGTLEKHFVSIITDAELLYHFFYLL
FCVFGVLLHPFFFSILLFDVVYREETLLNVIRSVTRNGRSIILTAVLALILVYMFSIIGY
MFFRDDFLVPVDEEYTPPAIPSAGDAGCTGDSATVSHMVPPDVVEQVVQATCSKPPGTAS
TELADDGGEMKERGLRLNDHGLRNGGGIGDILRAPSRKETLFVPRVVYDLLFFFIVIIIV
LNLIFGVIIDTFADLRSEKQQKELILKNTCFICGLNRSAFDNKTVSFEEHIKNEHNMWHY
LYFIVLVKVKDPTEFTGPESYVHAMVKANIQDWFPRLRAMSLAAVDGDGEQIELRSLKNL
LETNHIAVRELMTQIMELENKIWKMIRMLRIVQMKQMSTGRMTMKRSDL
Download sequence
Identical sequences A0A182LKU8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]