SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182M403 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182M403
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.52e-38
Family Matrix metalloproteases, catalytic domain 0.000077
Further Details:      
 
Domain Number 2 Region: 233-346
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.57e-29
Family Hemopexin-like domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A182M403
Sequence length 347
Comment (tr|A0A182M403|A0A182M403_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:ACUA008894-PA} KW=Complete proteome; Reference proteome OX=139723 OS=Anopheles culicifacies. GN= OC=Culicidae; Anophelinae; Anopheles; culicifacies species complex.
Sequence
MAKAFGEWSKYSKLRFVRVYDPSADIIVGFGSGHHGDNYPFDGPGNVLAHAFYPYEMNAY
GGDVHFDEDENWKENSTHLSEGVDFYSVAIHELGHSLGLAHSPVYSSLMFPYYKGIAQGT
LDYDDILAMYQLYIQNPHITDDPDWMYTTESVTSVYEIFTVTPAPRLPDWDSDPYPEQEP
VITSTTTSSTTEVYDIPITFVGDYETVDDHISRHHYQSPTAVITTHMPTEYVPVPDICSG
SFDAIGLLRGEIFIFKGPYLWRLTEKYRIKDGYPVRIWQVFRGFPKTVSHIDAVYERLDD
NAIVLFSGRFYWVFDALNFLHPEVRPLTDFGLPEELKRIDAAMVWRE
Download sequence
Identical sequences A0A182M403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]