SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A182NJ16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182NJ16
Domain Number 1 Region: 241-427
Classification Level Classification E-value
Superfamily MIR domain 2.88e-58
Family MIR domain 0.000000177
Further Details:      
 
Domain Number 2 Region: 428-598
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 8.63e-51
Family IP3 receptor type 1 binding core, domain 2 0.000000556
Further Details:      
 
Domain Number 3 Region: 1443-1556
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 6.02e-36
Family IP3 receptor type 1 binding core, domain 2 0.0045
Further Details:      
 
Domain Number 4 Region: 108-194
Classification Level Classification E-value
Superfamily MIR domain 0.0000000000000327
Family MIR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A182NJ16
Sequence length 3155
Comment (tr|A0A182NJ16|A0A182NJ16_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:ADIR007641-PA} KW=Complete proteome; Reference proteome OX=7168 OS=Anopheles dirus. GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MGDSTIGSVSFLHLGDIVSLYSEGSVSGFLSTLGLVDDRVVVCPGAGDLNDPPEKFRDCL
IKICPMNRYSAQKQFWKAAKQSTTTNTDTSLLKRLHHAAEIEKKQNESENKKLLGTVVQY
GSVVQLLHLKSNKYVTVNIRLPALLEKNAMRVYLDANGNEGSWFYIMPFYKLRSAGDNVV
VSDKVILKPVNANRQNLHVAATYELPDNPGSKEVNVLNSSTSWKITLFMEQRENQEDVLK
GGDVVRLFHAEQEKFLTMDEYKKHQHVFLRTTGRSSATAATSSKALWEVEVVQHDSCRGG
AGHWNSLFRFKHLATGYYLAAEIDEDISRTEKSSSSSHPQGGDSFRLVPVPHSTDIASVF
ELDSTTITRPEGLVPQSSYVRLRHLCSNTWVHATSVPIDIDDDKPVMSKVGCSAIKEDKE
AFQLIPVSPVEVRDLDFANDACKLLLAMSTKLENGTISSNERRSLIALLQDIVFFIAGQE
NDQNKSDALDLTINNPNRDRQKLLREQYILKQLFKILQGPFQETKGSEGPFLKIDELGDP
KNAPFKNIFRLCYRILKLSQQDYRKNQEYIAKHFGLMQKQIGYDILAEDTITALLHNNRK
LLEKHITAAEIETFVGLVRKNMQSWQSRFLDYLSDLCVSNKKAIAVTQELICKSVLSAKN
ADILIETFLREVDDDPLGYLNELERGNREFTEIREVDESSFGVQVDGESKGTAGNGKRKL
DEKKRYEVVLMWQNRTQSKSMSRLAQGLKIGRAVDTAILDYYRHQLNLFSNMCLNRQYLA
LNNLSPHLDIDLILRCMSDKTVPYDLRASFCRLMLHLHVDRDPQEPVTPVKYARLWSEIP
TVMSINDYDIEKQPDSNKEAVRARFNKTIAFVEDYLCNHVVSKMWFADQDQNKLTFEVVK
LARDLIYFGFYSFSDLLRLTKTLLNILDCVSSSEADGTGLPTGHIDSEEKGESALPGIAV
QTEADMAAASGPAIKDASLRKDSDSSAGGGSLLTTEFGMPKKLNRSASTVAVLAAVASMA
AGSSKLRSGSIPEAHGPGSNGGSAGAEGGVLRRIGDMGAVMTSLTLGPISTAIVSPTIQH
RKSVSQLMKEYPLVMDTKLKIIEILQFILDVRLDYRISCLLSIFKREFDENEQTAASANI
SVLPPTVIVPEAPTIVQPGVGGTSSADSSPTVSVVVPTADTTTQDANSSTGGDTISEVSL
MLSNTTTETTTTSESTSEGHGTMSCDSTTVPESSSSSSSKPETNLPPPTAENINLRQKNI
DLESIGYQAEGIFGCTEDTYNPLDLDGQGGRTFLRVLLHLIMHEYPALVSGALHLLFRHF
SQRHEVLHAFRQVQLLVSDSDVESYKQIKSDLDVLRQSVEKSELWVYKSKQTDDLLAGSG
GGEGGEGGEGGGTGAKGGNEQREGGAGAAGSKSGSSGAKGKPELVKQESQLNFDQGPELN
PEQSLEYKKIQQILIRMNKLCITATGPDGFVKPRKHEQRLLRNVGVHTVVLDLLQIPYDE
KDDYRMNELMRLAHEFLQNFCLGNQQNQILLHKQLDLFLNPGILEAETVCAIFKDNLNLC
NEVSDKVVQHFVHCIEIHGRHVEYLKFLQTIIKAENQFIRKCQDMVMQELVNAGEEVLVF
YNDKGSFNYFVELMRSYSAGTLADPSPLMYHIELVKLLACCTMGKNVYTEIKCNSLLALD
DIVAMISHPDCIPEVKVAYVDFLCHCYIDTEVEVKEIYSSNHMWCLFEKSFLIDINNVVK
GGSFTNRQLENYVCNEVMNILTTFFNSQFSDQSTALQKHVHLEEPRREDESHGAWEKQLN
RLITGQRYQIKRLLRQNSLNEKRQLIFVKILQNSFKLTQCKGLTPSQRFNVENCIRTLSE
KAKPRGIAIPIDLENQVVKMFNKTAMLSRQTSKWLLVTKQTKMERSQSQIMRMDRSIIEG
LQDIVSLLEDKLKPLVEAEQSLLVDILYRSELLFPLNTESRKKCETGDFIRHLIKHTEKL
LEEKEEKLCVKILKTLKEMMTIDCDYGDKGDHLRTILLKRYFGHDFTLQAPVAALPGAVG
PAVLQPANVSTAVGSPMASVSHGPGAKYLIRAGRTLHEVQNHLDKEGASDLVIELVIKSI
NSPSIFVEAIELGIALLEGGNPIIQKGMYNKFLSNDLSQSFFKVFFDKMKDAQQEIKSTV
TVNTSDMAANKASESKVEGKDLDKIGQRKNVNKVNGIVITEDFKEELQNAALMTQQSYIN
ARNLAATSDGTGSDNGDENSLMSIGSSALEDILAEKLEKHKDKDENNKLSNKVLVMQPIL
RFLQLLCENHNPELQNLLRNQNNKTNYNLVSETLMFLDCICGSTTGGLGLLGLYINENNV
SLINQTLETLTEYCQGPCHDNQNCIATHESNGLDIITALILNDINPLGKNRMDLVLELKN
NASKLLLAIMESRGDSENAERILANMNPKQLVDVACRAYHQDENILMLLNQSDGSGGGGG
GGGGGGTGGGGGSDDGYGSLRHELGDDAHDDDDVGVSPKEVGHNIYILCHQLAQHNKELA
GLLKIDSYGSSTGAATSSPVSIVPVFPGANPSSLGGGSPSGSSSSNTSSSTTTAASKANS
KTNQALLYYQTHTAQIEIVRHDRTLEQIVFPIPEICEYLTKDTKVRVLNTAERDDQGSKV
ADFFDRHEAMFNEMKWQKKLRGQPALFWVSSYMSLWSNILFNLAVLINLIVAFFYPFENV
VPELSFHLSSLIWIVMLVSLAIVITLPRQSGIRTFVVALILRLIFSCGPEPTLWLLGCIT
VIMKGVHIISLMGNYGTLEKHFVSIITDAELLYHFFYLLFCVFGVLLHPFFFSILLFDVV
YREETLLNVIRSVTRNGRSIILTAVLALILVYMFSIIGYMFFRDDFLVPVDEEYSPPAIN
GGEGSDCTGEPTVSHMVPPDVVEQVVQQTCSSLPGTGGSELAESSDEMKERGCDSMIMCI
ITTLNQGLRNGGGIGDILRAPSRKETLFVPRVIYDLLFFFIVIIIVLNLIFGVIIDTFAD
LRSEKQQKELILKNTCFVCGLNRSAFDNKTVSFEEHIKNEHNMWHYLYFIVLVKVKDPTE
FTGPESYVHAMVKANIQDWFPRLRAMSLAAVDGDGEQIELRSLKTLLETNHIAVRELMTQ
IMELENKMTEQRKQRQRHALLNPTTSTSYQFYPQL
Download sequence
Identical sequences A0A182NJ16

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]