SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182R981 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182R981
Domain Number 1 Region: 15-91
Classification Level Classification E-value
Superfamily Sema domain 0.0000000000000837
Family Sema domain 0.0038
Further Details:      
 
Domain Number 2 Region: 140-229
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000447
Family I set domains 0.066
Further Details:      
 
Domain Number 3 Region: 92-121
Classification Level Classification E-value
Superfamily Plexin repeat 0.000033
Family Plexin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A182R981
Sequence length 287
Comment (tr|A0A182R981|A0A182R981_ANOFN) Uncharacterized protein {ECO:0000313|VectorBase:AFUN002741-PA} KW=Complete proteome; Reference proteome OX=62324 OS=Anopheles funestus (African malaria mosquito). GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MFVYSANLQRTIKIEILSQEYTVFYIGTNAGRIYKIVQYLRNGESKSKLLDIFEIAQNEA
IQVMELSQKRKSLYVATDYRIKQIDLAMCNRRYDNCFRCVKDPYCGWDKDTSTCKPYEPG
LLQDVGNETYDICDTSVLKKKIIVTYGQSVHLGCFVKIPEILKDQTVTWYHHSKEKGRYE
IKYNPTKYIETTERGLVVISVNEADGGRYDCHLGGSLLCSYNITVDAHRCTPPNKTNDYQ
KIYSDWCHEFEKYKSAMKTWEKKQAQCSRQNYSNQHPNDVFARTPNV
Download sequence
Identical sequences A0A182R981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]