SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182SAE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182SAE8
Domain Number 1 Region: 1-49
Classification Level Classification E-value
Superfamily LEM domain 0.000000000000216
Family LEM domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A182SAE8
Sequence length 209
Comment (tr|A0A182SAE8|A0A182SAE8_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:AMAM002857-PA} KW=Complete proteome; Reference proteome OX=74869 OS=Anopheles maculatus. GN= OC=Culicidae; Anophelinae; Anopheles; Anopheles maculatus group.
Sequence
MDNLDQLADDELRLRLVQYGFPNLPVTSTTRKILIKKLRHHIDTENQKLRRESSKAARYS
SGEESDGNDGRKTVTAAQRKMYTTTTSSSSSSNSSTTRSQRATVGSGFSASVGSSVSMPP
PAPANVVRSSITRVPISISSSPSSSASTPHSVNSNSNSFAGTNGASPNNHRSSSKNSSPT
VGSTVYISPLIVHDSEEEDYSPPLRAGIG
Download sequence
Identical sequences A0A182SAE8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]