SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A182U6E4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182U6E4
Domain Number 1 Region: 1-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.53e-95
Family Capz beta-1 subunit 0.0000000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A182U6E4
Sequence length 270
Comment (tr|A0A182U6E4|A0A182U6E4_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:AMEC014760-PA} KW=Complete proteome; Reference proteome OX=34690 OS=Anopheles melas. GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MDCALDLMRRLPPQQIEKNLIDLIDLAPDLCEDLLTSVDQPLKIAKDKETGKDYLLCDYN
RDGDSYRSPWSNTYDPPLEDGSMPSERLRKLEVEANHAFDQYREMYYEGGVSSAYLWDLE
HGFAGVILIKKAGEGNQKTKGCWDSIHVVEVQEKSSGRTAHYKLTSTAMLWLQTNKQGSG
TINLGGSLTRQIEQDAPVSETSPHIANIGRIVEDMENKIRNTLNEIYFGKTKDIVNGLRS
IQSLADTNQQATMKKDLAAALLRRTGKSEN
Download sequence
Identical sequences A0A182HVE4 A0A182U6E4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]