SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A182VAZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182VAZ1
Domain Number 1 Region: 8-284
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.62e-106
Family Capz alpha-1 subunit 0.0000000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A182VAZ1
Sequence length 289
Comment (tr|A0A182VAZ1|A0A182VAZ1_ANOME) Uncharacterized protein {ECO:0000313|VectorBase:AMEM011870-PA} KW=Complete proteome; Reference proteome OX=30066 OS=Anopheles merus (Mosquito). GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MADVDDVISDQDKIRIASDFLMHAPPGEFNEVFNDVRELLNDDRLLKEGASAACAQYNKD
QLTPVILENSELAVLITEFNDLGGGRFFDPRTKQSFKFDHLRKEASDLQNHDGDHTSEQW
RAMLDIETLTYSANHYRNGSCSVFGRTVNGQITLNVCIEDHQFQPKNFWNGRWRSVWAIT
FPATGGGTAELKGSLKLQVHYYEDGNVQLVSAKDCRETVPITNEANTAKEIIRLIEESEH
DYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWSKIVSYSIGKELKTQ
Download sequence
Identical sequences A0A182KNZ2 A0A182VAZ1 Q7Q5Y1
AGAP006141-PA AGAP006141-PB XP_001688794.1.40869 XP_316203.2.40869 AGAP006141-PA|hypothetical AGAP006141-PB|hypothetical 7165.AGAP006141-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]