SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A182WC14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182WC14
Domain Number 1 Region: 241-427
Classification Level Classification E-value
Superfamily MIR domain 1.05e-58
Family MIR domain 0.000000172
Further Details:      
 
Domain Number 2 Region: 428-598
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.31e-50
Family IP3 receptor type 1 binding core, domain 2 0.000000528
Further Details:      
 
Domain Number 3 Region: 1451-1564
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 3.01e-36
Family IP3 receptor type 1 binding core, domain 2 0.0045
Further Details:      
 
Domain Number 4 Region: 108-194
Classification Level Classification E-value
Superfamily MIR domain 0.0000000000000327
Family MIR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A182WC14
Sequence length 3165
Comment (tr|A0A182WC14|A0A182WC14_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:AMIN007893-PA} KW=Complete proteome; Reference proteome OX=112268 OS=Anopheles minimus. GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MGDSTIGSVSFLHLGDIVSLYSEGSVSGFLSTLGLVDDRVVVCPGAGDLNDPPEKFRDCL
IKICPMNRYSAQKQFWKAAKQSTTTNTDTSLLKRLHHAAEIEKKQNESENKKLLGTVVQY
GSVVQLLHLKSNKYVTVNIRLPALLEKNAMRVYLDANGNEGSWFYIMPFYKLRSAGDNVV
VSDKVILKPVNANRQNLHVAATYELPDNPGSKEVNVLNSSTSWKITLFMEQRENQEDVLK
GGDVVRLFHAEQEKFLTMDEYKKQQHVFLRTTGRSSATAATSSKALWEVEVVQHDSCRGG
AGHWNSLFRFKHLATGYYLAAEIDEDISRTEKSSSSSHPQGGDSFRLVPVPHSTDIASVF
ELDSTTITRPEGLVPQSSYVRLRHLCSNTWVHATSVPIDIDDDKPVMSKVGCSAIKEDKE
AFQLIPVSPVEVRDLDFANDACKLLLAMSTKLENGTISSNERRSLIALLQDIVFFIAGQE
NDQNKSDALDLTINNPNRDRQKLLREQYILKQLFKILQGPFQETKNNDGPFLKIDELGDP
KNAPFKNIFRLCYRILKLSQQDYRKNQEYIAKHFGLMQKQIGYDILAEDTITALLHNNRK
LLEKHITAAEIETFVGLVRKNMQSWQSRFLDYLSDLCVSNKKAIAVTQELICKSVLSAKN
ADILIETFLREVDDDPLGYLNELERGNREFTEIREVDESSSGAVAADGESKGTGSTSNGK
RKLDEKKRYEVVLMWQNRTQSKSMSRLAQGLKIGRAVDTAILDYYRHQLNLFSNMCLNRQ
YLALNNLSPHLDIDLILRCMSDKTVPYDLRASFCRLMLHLHVDRDPQEPVTPVKYARLWS
EIPTVMSINDYDIEKQPDSNKEAVRARFNKTIAFVEDYLCNHVVSKMWFADQDQNKLTFE
VVKLARDLIYFGFYSFSDLLRLTKTLLNILDCVSSSEADGTGLPTGHIDSADEKGTSVPG
IAVQDETSAVPTSGAGKETNVRKDSNDGGGLLTTEFGSPKKLNRSASTVAVLAAIEATKC
ASKFRSGSIPEANIGVPGSNNSGEGVGGNAGAEGGVLRRIGDMGAVMTSLTLGPISTAIV
SPTIQHRKSVSQLMKEYPLVMDTKLKIIEILQFILDVRLDYRISCLLSIFKREFDENEQT
SSTASLPVLPPTVIVPAETPTIVQPGAVVPSSTAIDPSPTVSVVVPKENIPQDANSSIGG
DTTFEVSLTLSNTTTETTATTTSDSTSEGHGTMSSEGSASITEGHSSNTSKTDTSLPPTT
ENINLRQKNIDLESIGYQAEGIFGCTEDTYNPLDLDGQGGRTFLRVLLHLIMHEYPALVS
GALHLLFRHFSQRHEVLHAFRQVQLLVSDSDVESYKQIKSDLDVLRQSVEKSELWVYKSK
QTDDLLAGGGGEGGEGGDGGGTGGGKGGDQGEGGTGGGSKSGAGNTKGKPELVKQESQLN
FDQGPELNPEQSLEYKKIQQILIRMNKLCITATGPDGFVKPRKHEQRLLRNVGVHTVVLD
LLQIPYDEKDDYRMNELMRLAHEFLQNFCLGNQQNQILLHKQLDLFLNPGILEAETVCAI
FKDNLNLCNEVSDKVVQHFVHCIEIHGRHVEYLKFLQTIIKAENQFIRKCQDMVMQELVN
AGEEVLVFYNDKASFNYFVELMRSYSAGTLADSSPLMYHIELVKLLACCTMGKNVYTEIK
CNSLLALDDIVAMISHPDCIPEVKVAYVDFLCHCYIDTEVEVKEIYSSNHMWCLFEKSFL
IDINNVVKGGSFTNRQLENYVCNEVMNILTTFFNSQFSDQSTALQRHTLLEEPRVEEEGS
PGAWELQLNRLILGQRYQIKRLLRQNSLNEVRLPMLKKLKRQLIFVKILQNSFKLTQCKG
LTPSQRFNVENCIRTLSEKAKPRGIAIPIDLENQVVKMFNKTAMLSRQTSKWLLVTKQTK
MERSQSQIMRMDRSIIEGLQDIVSLLEDKLKPLVEAEQSLLVDILYRSELLFPLNTESRK
KCETGDFIRHLIKHTEKLLEEKEEKLCVKILKTLKEMMTIDCDYGDKGDHLRTILLKRYF
GHDFTLQAPIPALPGAVGPAVLQPVNVSTVVSGTMASVSHGPGAKYLIRAGRTLHEVQNH
LDKEGASDLVIELVIKSINSPSIFVEAIELGIALLEGGNPIIQKGMYNKFLSNDLSQSFF
KVFFDKMKDAQQEIKSTVTVNTSDMAANKASESKVEGKDLDKIGQRKNVNKVNGIVITED
FKEELQNAALMTQQSYINARNLAATSDGTGSDNGDENSLMSIGSSALEDILAEKLEKHKD
KDENNKLSNKVLVMQPILRFLQLLCENHNPELQNLLRNQNNKTNYNLVSETLMFLDCICG
STTGGLGLLGLYINENNVTLINQTLETLTEYCQGPCHDNQNCIATHESNGLDIITALILN
DINPLGKNRMDLVLELKNNASKLLLAIMESRGDSENAERILANMNPKQLVEVACRAYHQD
ENILMLLNQSDGSSSGGGGGVGGSAGGSGTSDDGYGSLRHDLGDDGHDDDDVGVSPKEVG
HNIYILCHQLAQHNKELAGLLKIDSYNNGTTGTGTAPPAVPTFPGANPSSLGGGPPSSSS
SSSATSKANSKTNQALLYYQTHTAQIEIVRHDRTLEQIVFPIPEICEYLTKDTKVRVLNT
AERDDQGSKVADFFDRHEAMFNEMKWQKKLRGQPALFWVSSYMSLWSNILFNLAVLINLI
VAFFYPFENALPELSLHLSSLIWMVMLASLAIVITLPRQSGIRTFVVALILRLIFSCGPE
PTLWLLGCITVIMKGVHIISLMGNYGTLEKHFVSIITDAELLYHFFYLLFCVFGVLLHPF
FFSILLFDVVYREETLLNVIRSVTRNGRSIILTAVLALILVYMFSIIGYMFFRDDFLVPV
DEEYGATTSSAEDTDCNGEPTISHMVPPDVVEQVVQQTCSKMSPPGSELAESNDGGEMKE
RGCDSMIMCIITTLNQGLRNGGGIGDILRAPSRKETLFVPRVVYDLLFFFIVIIIVLNLI
FGVIIDTFADLRSEKQQKELILKNTCFVCGLNRSAFDNKTVSFEEHIKNEHNMWHYLYFI
VLVKVKDPTEFTGPESYVHAMVKANIQDWFPRLRAMSLAAVDGDGEQIELRSLKNLLETN
HIAVRELMTQIMELENKMTEQRKQRQRHALLNPTTSTSYQFYPQL
Download sequence
Identical sequences A0A182WC14

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]