SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A182WTF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182WTF0
Domain Number 1 Region: 2-267
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-96
Family Capz beta-1 subunit 0.00000000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A182WTF0
Sequence length 275
Comment (tr|A0A182WTF0|A0A182WTF0_ANOQN) Uncharacterized protein {ECO:0000313|VectorBase:AQUA000804-PA} KW=Complete proteome; Reference proteome OX=34691 OS=Anopheles quadriannulatus (Mosquito). GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MSEQQMDCALDLMRRLPPQQIEKNLIDLIDLAPDLCEDLLTSVDQPLKIAKDKETGKDYL
LCDYNRDGDSYRSPWSNTYDPPLEDGSMPSERLRKLEVEANHAFDQYREMYYEGGVSSAY
LWDLEHGFAGVILIKKAGEGNQKTKGCWDSIHVVEVQEKSSGRTAHYKLTSTAMLWLQTN
KQGSGTINLGGSLTRQIEQDAPVSETSPHIANIGRIVEDMENKIRNTLNEIYFGKTKDIV
NGLRSIQSLADTNQQATMKKDLAAALLRRTGKSEN
Download sequence
Identical sequences A0A182L299 A0A182UQT7 A0A182WTF0 A0A1S4GX64
AGAP007864-PA|hypothetical AGAP007864-PB|hypothetical AGAP007864-PC|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]