SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A182Y2R4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182Y2R4
Domain Number 1 Region: 8-284
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.05e-106
Family Capz alpha-1 subunit 0.0000000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A182Y2R4
Sequence length 289
Comment (tr|A0A182Y2R4|A0A182Y2R4_ANOST) Uncharacterized protein {ECO:0000313|VectorBase:ASTEI02750-PA} KW=Complete proteome; Reference proteome OX=30069 OS=Anopheles stephensi (Indo-Pakistan malaria mosquito). GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MADVDDVISDQDKIRIASDFLMHAPPGEFNEVFNDVRELLNDDRLLKEGASAACAQYNKD
QLTPVILENSEIAVLVTEFNDLGGGRFFDPRSKQSFKFDHLRKEASDLQNHDGDHTSEQW
RAMLDIETLTYSANHYRNGSCSVFGRTVNGQITLNVCIEDHQFQPKNFWNGRWRSVWAIT
FPASGGGTAELKGSLKLQVHYYEDGNVQLVSAKDCRETVPITNEANTAKEIIRLIEESEH
DYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWSKIVSYSIGKELKTQ
Download sequence
Identical sequences A0A182Y2R4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]