SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A183C5S6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183C5S6
Domain Number 1 Region: 26-308
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.24e-77
Family Capz alpha-1 subunit 0.000000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A183C5S6
Sequence length 325
Comment (tr|A0A183C5S6|A0A183C5S6_GLOPA) Uncharacterized protein {ECO:0000313|WBParaSite:GPLIN_000822100} KW=Complete proteome; Reference proteome OX=36090 OS=Globodera pallida (Potato cyst nematode). GN= OC=Tylenchomorpha; Tylenchoidea; Heteroderidae; Heteroderinae; Globodera.
Sequence
MLFPVPIQTISTGFPQTFVMSSEELTDAEKARIASDFLLQSPPGEFNEVFSDVRTLLQDD
ALLEKGTCLEAVRHYNKAQFATVKSDPGVEHPTLITEHNELADGRFMDPKSGRVFKYDHL
HKEAMDSHPAGPKDIDEKLEPWRKALQKELDEYIYEHFHLTGVATVFTPLHQHKEPKLVV
LCIESHQYQPKNYWNGRWRSEWHLPNFDGKTAVQKCTGKLRLQVHYYEDGNVQLISEKEA
AVEVKMTNDREASAREVLRAICEAESAYQRSIQESQEHMESTFKALRRQLPVTRSKLNWL
NFHSFRITQQEMKQPPSAGQQQQSQ
Download sequence
Identical sequences A0A183C5S6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]