SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183DZF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183DZF5
Domain Number 1 Region: 4-93
Classification Level Classification E-value
Superfamily BEACH domain 1.83e-29
Family BEACH domain 0.0003
Further Details:      
 
Domain Number 2 Region: 107-151
Classification Level Classification E-value
Superfamily BEACH domain 0.0000353
Family BEACH domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A183DZF5
Sequence length 231
Comment (tr|A0A183DZF5|A0A183DZF5_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:GPUH_0001411101-mRNA-1} KW=Complete proteome; Reference proteome OX=637853 OS=Gongylonema pulchrum. GN= OC=Spiruromorpha; Spiruroidea; Gongylonematidae; Gongylonema.
Sequence
LGLPRLFVLIHRQALESSVVSSSLNHWIDLIFGYKQTGKAAVDAINVFHPATYRASTMNS
VNEEHDELSLTALRTMVKTYGQMPLQLFHSPHLPHLTEKDRHNASSFLTTYRASTMNNVN
EEHDELSLTALRTMVKTYGQMPLQLFHSPHLPHLTEKDRHNASSFLTSPLITVSGIRWGE
FVGSPGSEFGKLIVILNEEPPCDTGHISQIVAFSDGSCFAYPSNTCYVYKV
Download sequence
Identical sequences A0A183DZF5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]