SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183IHA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183IHA1
Domain Number 1 Region: 4-214
Classification Level Classification E-value
Superfamily PTPA-like 1.7e-74
Family PTPA-like 0.00000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A183IHA1
Sequence length 214
Comment (tr|A0A183IHA1|A0A183IHA1_9BILA) Phosphotyrosyl phosphatase activator {ECO:0000256|RuleBase:RU361210} KW=Complete proteome; Reference proteome OX=241478 OS=Soboliphyme baturini. GN= OC=Dioctophymatida; Dioctophymatoidea; Soboliphymatidae; Soboliphyme.
Sequence
MTDVKITYIVPKREVLSEADMKKWFSSQAYGDFLDFVFRINTELTSKPNTECGKPSENAT
SVVEMLDLLESWIADYPPINDAKQRFGNKAFRDWHKRLTECAVEILKALLDQKSAAAIEL
APYLCDSFGNPTRIDYGTGHESCFLMFLCCLFKLRFFVRTDYPAVGGIVFERYLYLCRKL
QQTYRIEPAGSHGVWSLDDYQFVPFLWGSAQFIS
Download sequence
Identical sequences A0A183IHA1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]