SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183IX01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183IX01
Domain Number 1 Region: 87-156
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.31e-29
Family Skp1 dimerisation domain-like 0.0000256
Further Details:      
 
Domain Number 2 Region: 3-72
Classification Level Classification E-value
Superfamily POZ domain 1.05e-22
Family BTB/POZ domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A183IX01
Sequence length 163
Comment (tr|A0A183IX01|A0A183IX01_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:SBAD_0000844901-mRNA-1} KW=Complete proteome; Reference proteome OX=241478 OS=Soboliphyme baturini. GN= OC=Dioctophymatida; Dioctophymatoidea; Soboliphymatidae; Soboliphyme.
Sequence
MSKKVKLQSSDHELFEVEINVIRLSNTIKTMLEDLGVEDEENESEHIPLPNVNAAILKKV
IQWCTYHKDDSPPLEDDDTKEKRSDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDV
TCKTVANMIKGKTPEEIRRTFNIKNDFTPQEEEQVLDFCSCWI
Download sequence
Identical sequences A0A183IX01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]