SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183L3C9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183L3C9
Domain Number 1 Region: 1-73
Classification Level Classification E-value
Superfamily BEACH domain 3.01e-26
Family BEACH domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A183L3C9
Sequence length 93
Comment (tr|A0A183L3C9|A0A183L3C9_9TREM) Uncharacterized protein {ECO:0000313|WBParaSite:SCUD_0002184001-mRNA-1} KW=Complete proteome; Reference proteome OX=6186 OS=Schistosoma curassoni. GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MFHSVRDTWISASRHNMADVRELIPEFFYLPDFLINSNHFEMGIKQNGVEVNNVVLPPWA
KSDPREFIRVHREVSIYKLTCLCLSAYIYIYIY
Download sequence
Identical sequences A0A183L3C9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]