SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183TSV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183TSV6
Domain Number 1 Region: 2-27
Classification Level Classification E-value
Superfamily BEACH domain 0.0000458
Family BEACH domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A183TSV6
Sequence length 131
Comment (tr|A0A183TSV6|A0A183TSV6_SCHSO) Uncharacterized protein {ECO:0000313|WBParaSite:SSLN_0002028501-mRNA-1} KW=Complete proteome; Reference proteome OX=70667 OS=Schistocephalus solidus (Tapeworm). GN= OC=Diphyllobothriidea; Diphyllobothriidae; Schistocephalus.
Sequence
LRKAIEGQIQSFGQTPSQLLTEPHPPRGSALHVCPSIFTPLTQEVCLRVKLPSNSPIVAV
FAHTHPTLTSQPAVVTVAANYVFAVNRWNNAAAGDLLFSFSAANCGFSVCLCACPRKSNL
VGSSNVVINDV
Download sequence
Identical sequences A0A183TSV6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]