SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A183U4W2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183U4W2
Domain Number 1 Region: 87-162
Classification Level Classification E-value
Superfamily MIR domain 1.44e-21
Family MIR domain 0.0000677
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A183U4W2
Sequence length 213
Comment (tr|A0A183U4W2|A0A183U4W2_TOXCA) Uncharacterized protein {ECO:0000313|WBParaSite:TCNE_0000353201-mRNA-1} KW=Complete proteome OX=6265 OS=Toxocara canis (Canine roundworm). GN= OC=Ascaridoidea; Toxocaridae; Toxocara.
Sequence
MAVIFLYVLFNFLNFFFPKSSKFLSPIPSLFLRDPTSSVVLFTIAGFIEASYLNCSSRLH
QYLNHFLNLANGWIDSVRTFLLDSKWYIAALKGKCKRGEAIKCGDKIRLMHLTTKCLLHS
HMFNAPLSRGNQEVSCFGKNGEGDTGDHWIVTCNTDEWLRGEPQTAADLCGIQTCPFITR
GAVSRKVEVKGGTRITGPYFTCSGLSLLVPFGC
Download sequence
Identical sequences A0A183U4W2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]