SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183VJN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183VJN5
Domain Number 1 Region: 1-115
Classification Level Classification E-value
Superfamily BEACH domain 6.8e-47
Family BEACH domain 0.00000893
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A183VJN5
Sequence length 139
Comment (tr|A0A183VJN5|A0A183VJN5_TRIRE) Uncharacterized protein {ECO:0000313|WBParaSite:TRE_0000069101-mRNA-1} KW=Complete proteome; Reference proteome OX=157069 OS=Trichobilharzia regenti (Nasal bird schistosome). GN= OC=Schistosomatoidea; Schistosomatidae; Trichobilharzia.
Sequence
LSNFEYLMYLNTQAGRSYNDLIQYPVFPWVLADYDSEELDLSRPETFRDLSKPMGAQTPD
RLAQFQRRYKEWDDPTGETPPYHYGTHYSSAMIVASYLFRMEPFAQHFLKLQVCRNLLPF
VVFVRYSCQKLGLSIREYF
Download sequence
Identical sequences A0A183VJN5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]