SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A193D6I0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A193D6I0
Domain Number 1 Region: 36-203,266-285
Classification Level Classification E-value
Superfamily Cytochrome f, large domain 7.72e-97
Family Cytochrome f, large domain 0.0000000138
Further Details:      
 
Domain Number 2 Region: 203-265
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 4.4e-20
Family Cytochrome f, small domain 0.0000612
Further Details:      
 
Domain Number 3 Region: 282-320
Classification Level Classification E-value
Superfamily Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00000000000000144
Family Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A193D6I0
Sequence length 320
Comment (tr|A0A193D6I0|A0A193D6I0_9POAL) Cytochrome f {ECO:0000256|HAMAP-Rule:MF_00610} OX=300125 OS=Rottboellia cochinchinensis. GN=ROCO_g033 OC=Rottboelliinae; Rottboellia.
Sequence
MENRKTFSWLKEQMIRSISVSIMIYVITRTSISNAYPIFAQQGYENPREATGRIVCANCH
LANKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQVLANGKKGGLNVGAVLILPEGFELAP
PDRISPELKEKIGNLSFQSYRPNKKNILVIGPVPGKKYSEIVFPILSPDPATKKDVHFLK
YPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGIVKKILRKEKGGYEISIVDASDGRQVID
IIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQ
VFLVLKKKQFEKVQLYEMNF
Download sequence
Identical sequences A0A059Q8K1 A0A142K1C8 A0A142K1L3 A0A142K1U8 A0A172FJ75 A0A172FJF6 A0A172FJN5 A0A172FJY3 A0A193D3B5 A0A193D6I0 A0A193D6Q1 A0A193D7G1 A0A193D916 A0A193D9E2 A0A193DA63 A0A193DB37 A0A193DBE5 A0A1B1Q656 A0A1B4XTY5 A0A1X9ZNY9 A0A1Y0ADR2 A0A1Y0AEM7 A0A1Y0AF05 A0A1Y0AF28 A0A1Y0AG54 A0A1Y0AGA5 A0A1Y0AGK3 A0A1Y0AHX7 A0A1Y0AI67 A0A1Y0AJ23 A0A1Y0AJN6 A0A1Y0AKK3 A0A1Y0AL27 A0A1Y0AM59 A0A1Y0AMN6 A0A1Y0AMQ0 A0A1Y0ANC0 A0A1Y0APG7 A0A1Y0AQN2 A0A1Y0AS31 A0A220VXT5 A0A220VYT7 A0A291HYA3 A0A2H4HSG5 A1E9T7 C8XU28 W8NVN4
GRMZM2G448174_P01 GRMZM2G448174_T01|PACid:20865060 XP_020401855.1.34533 YP_899420.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]